PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G210200.1.p
Common NamePRUPE_ppa008568mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Dof
Protein Properties Length: 327aa    MW: 34843 Da    PI: 7.0838
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G210200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.6e-393291261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  Prupe.5G210200.1.p 32 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 91
                        57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-293190IPR003851Zinc finger, Dof-type
PfamPF027012.5E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MQDIHSVGGA RFFAGSGGGG GDRRLRPHHH PNQQALKCPR CDSLNTKFCY YNNYNLSQPR  60
HFCKSCRRYW TKGGVLRNVP VGGGCRKTKR SKPKSSSSLS PPPPPPQLNS ATDQHKASSH  120
SSSESSSLTN TTTAAAAAAT ATEAVSAPSS TGSASNLLSN IHRQESKFFG SQSGGFEPGA  180
EAALLEQSTE MNGMFSEIGS FTSLITSSND VPFGFGNIGG TDASVSPFRV NQQAQGDHQN  240
QWAEQNQSEE LKMQELSGGL MDQTGQVDLS VYHGRSNGGG GGVFGSLDWQ ACSGDQGLFD  300
LPNTVDQAYW SQSQWTDQDH PTLYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572541e-60DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209350.10.0hypothetical protein PRUPE_ppa008568mg
TrEMBLM5WA030.0M5WA03_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03520.12e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-55OBF binding protein 4